Amigo details
August 3rd, 2008Amigo details
AmiGO: WWP1 Details
Information Symbol WWP1 Name(s) NEDD4-like E3 ubiquitin-protein ligase WWP1 Type protein Species Homo sapiens (human) Synonyms IPI00013009 IPI00328376 IPI00328377 (more...)
amigos.com - Site Information from Alexa
Alexa Site Overview for amigos.com - learn more about Amigos.com statistics, where visitors come from, who owns the site, what are some related links, and more. (more...)
Amigos Online Account Access (eAccount) | Amigos Library Services
... your IT person, change your caching option in your browser. If you would like to set up an online access account, please contact Accounts Receivable, ar@amigos.org, for details. To ... (more...)
AmiGO: spas Details
Primary Peptide Sequence. Longest sequence shown. SubName: Full=LD23843p; MAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKELAIELYRKGIKE ... (more...)
AMIGO Shelters -
... details... ... 2008-2009 AMIGO Shelters. All rights reserved. Site designed for I.E 7 or ... (more...)
Welcome to the Washington DC Chapter of Amigos de las Américas ...
This is an opportunity for you and your parents to learn more about the summer 2009 programs, hear from veteran volunteers about their experiences with Amigos, and learn details ... (more...)
NetLibrary eBook Shared Resource Collections | Amigos Library Services
Amigos members are invited to participate in the Amigos/NetLibrary Shared Resource ... 2009 Community College Collection (239 titles) - Details and Information; Shared Ready ... (more...)
amigobingo - amigobingo.com - The best Bingo games online for ...
Play the letter patterns each day and spell amigo to win. More Details Here. Current Promotions.Check Out our current promotions. More Details Here. (more...)
New Samba De Amigo Details Emerge For Wii - GayGamer.net
New Samba De Amigo Details Emerge For Wii. A while back, we learned that famed Dreamcast game, Sambo De Amigo, would be shaking its way onto the Wii. (more...)
programs ? AMIGOS
Amigos Volunteers abroad will collaborate with volunteer international partner agencies ... View details... Honduras. La Paz, Honduras Length: 6 weeks; Starts: 2009/07/01; ... (more...)